PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn049161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TALE
Protein Properties Length: 319aa    MW: 35085.1 Da    PI: 6.2875
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn049161genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-091091461954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e++ LA+k gLt +qV +WF N R +
  Achn049161 109 FEHflHPYPKVSEKTMLARKAGLTRSQVANWFINARVR 146
                 664459******************************88 PP

2BELL67.62.4e-221433072
        BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                +q+v+ssF++vag+g+akpYt+lAlk+iSrhFr+L dai++qi
  Achn049161  1 MQIVVSSFDVVAGHGAAKPYTTLALKTISRHFRSLHDAISSQI 43
                9*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075265.0E-16140IPR006563POX domain
PROSITE profilePS5007112.17987150IPR001356Homeobox domain
CDDcd000866.19E-1290151No hitNo description
SMARTSM003891.6E-890154IPR001356Homeobox domain
SuperFamilySSF466898.55E-1791157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-2693156IPR009057Homeodomain-like
PfamPF059201.7E-16107146IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MQIVVSSFDV VAGHGAAKPY TTLALKTISR HFRSLHDAIS SQIRVTQKNL GEQDSTPSVQ  60
GGLPRLRYVG QQLGQQRALL QQFGVMRHSW RPQRGLPESS VSVLRAWLFE HFLHPYPKVS  120
EKTMLARKAG LTRSQVANWF INARVRLWKP MVEEMYKEEF GEIDFKSSPE HAPEEARDKS  180
WTSEDTGEAA DDGQIGQFDD SKSDLIPDFG MQGFTARLGF QNAACGDNKF GSGMTKLHGD  240
QRPNTDNHDV SPDGIFPLDQ TGDGNSNFSE LGSFSVGKQV SLALGFQHCE KDSLFVSGGV  300
QFSGDLTVAS SMSHDSSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-1696154563Homeobox protein Meis2
4xrm_B6e-1696154563Homeobox protein Meis2
4xrs_A5e-1696153158Homeobox protein Meis1
4xrs_B5e-1696153158Homeobox protein Meis1
5bng_A5e-1696154159Homeobox protein Meis2
5bng_B5e-1696154159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071936.11e-112PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_012071937.11e-112PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_012071938.11e-112PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9SIW12e-78BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLA0A067L2431e-112A0A067L243_JATCU; Uncharacterized protein
STRINGVIT_18s0001g13150.t011e-109(Vitis vinifera)
STRINGPOPTR_0002s03240.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-72BEL1-like homeodomain 7